PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 353aa    MW: 40633.3 Da    PI: 8.6674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40910.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-1258103146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W+ eEde l++ v ++G++ W++I ++  + Rt+k+c++rw +
       KHN40910.1  58 KGPWSSEEDEVLLRHVSKYGPREWSSIRSKGLLPRTGKSCRLRWVN 103
                      79*************************8876677**********87 PP

2Myb_DNA-binding47.93.1e-15114154345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+ l +++ +q+G++ W++Ia +++ gRt++++k++w 
       KHN40910.1 114 KFTAEEERLVIELQAQYGNK-WAKIATYLQ-GRTDNDVKNFWS 154
                      79******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71853105IPR017930Myb domain
SuperFamilySSF466891.37E-2856153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-2056106IPR009057Homeodomain-like
SMARTSM007171.3E-1157107IPR001005SANT/Myb domain
CDDcd001676.82E-1160105No hitNo description
PfamPF139212.1E-1161111No hitNo description
PROSITE profilePS5129422.332106161IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-18107159IPR009057Homeodomain-like
SMARTSM007175.5E-13111159IPR001005SANT/Myb domain
CDDcd001674.64E-11114153No hitNo description
PfamPF002491.1E-13114154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MRKVGSKNPL HCVHVDQKPN HATCCHATNI RKQNFRNVPR VRRKERGMEI RELEMIKKGP  60
WSSEEDEVLL RHVSKYGPRE WSSIRSKGLL PRTGKSCRLR WVNKLRPNLK TGCKFTAEEE  120
RLVIELQAQY GNKWAKIATY LQGRTDNDVK NFWSSRRKRL ERMLQKPPAS KPKKNKGKAH  180
LNQVQQVEEM VPPCSSNQVE EILSYATSYM GNTLVFEMIN LQDLIKPNYQ QLENDYLSAV  240
EVDATPLHTV PSFESSSGYN FPLLPEPEPL LDFPLFPECQ DLVPEPFDPN FVYGFEEKKC  300
LQCACSSSQK LGTRLPTFGL EGNSQSASSN GFFKDFPSEI FEYFEHIPTS SDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-275615925126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534696.10.0PREDICTED: myb-related protein 340-like
TrEMBLA0A0B2S6R50.0A0A0B2S6R5_GLYSO; Transcription factor GAMYB
STRINGGLYMA09G00371.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.16e-63MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]